PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010927238.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family HB-PHD
Protein Properties Length: 697aa    MW: 79011.4 Da    PI: 8.2923
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010927238.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox34.73.1e-114394811153
                     HHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox  11 qleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                      +e L ++F++n  ps++ +e L+k+lg++ ++V+ WF+N R+
  XP_010927238.1 439 AVEKLRQVFAENELPSRTVKENLSKQLGISSEKVSKWFKNARY 481
                     5789**************************************7 PP

2PHD30.21.1e-10165218151
                     SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSSTBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpegewlCeeCkek 51 
                     +C+ C++  +  +++++lCd +C+  fH+kCl+++le+ +  ++ wlC+ C++k
  XP_010927238.1 165 FCAKCRSreAFPDNDIILCDgTCNCGFHQKCLEPPLENIPPGDQVWLCKFCECK 218
                     588888855455********56***************8888888*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579032.88E-13156220IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.103.0E-12161219IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.469163218IPR019787Zinc finger, PHD-finger
PROSITE patternPS013590163215IPR019786Zinc finger, PHD-type, conserved site
CDDcd155041.24E-26165215No hitNo description
PfamPF006283.3E-8165218IPR019787Zinc finger, PHD-finger
SMARTSM002497.9E-7165216IPR001965Zinc finger, PHD-type
Gene3DG3DSA:1.10.10.607.4E-12423480IPR009057Homeodomain-like
PROSITE profilePS5007112.244426486IPR001356Homeobox domain
SMARTSM003892.4E-8428490IPR001356Homeobox domain
SuperFamilySSF466896.42E-10429490IPR009057Homeodomain-like
CDDcd000861.72E-8429487No hitNo description
PfamPF000461.1E-8439481IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 697 aa     Download sequence    Send to blast
MRKKNIPNGK PGESLQRISD SSAAKGRCSL QFLGNNTSCI CHKGNRKIAA GDRVIKLDKR  60
KRRKRKKNNI EYDEVSRLQR RARYLLIKMK LEQNLIDAYS GDGWNGHSRE KIKPENELQR  120
AKKQILKCKL GIRDAIHQLD LLSSIGSIED SVMHPDGSVF HECIFCAKCR SREAFPDNDI  180
ILCDGTCNCG FHQKCLEPPL ENIPPGDQVW LCKFCECKTE ILEAVNAHLG TCFSANSRWE  240
DIFKEATTDP DVENTYLNPA EDWPSEDSED EDYNPEKNVN SASRTGIAEN MTGDSSSSSS  300
LFCSSDGAMS CSESIHTYSN GKSCDVEHKE GNEANFVDSI INAEYGETND CEIMSYQRQR  360
RDVDYKKLHD DMFGKDLADN EHQSEDEDWC PHRSTRRRIK STTGTTLAKC VNEDGCADIV  420
LTEKISHEKK PLFRIPLNAV EKLRQVFAEN ELPSRTVKEN LSKQLGISSE KVSKWFKNAR  480
YAALKMRKAG ITKSHHVNTI TKRSRVSAGK AGSFDEVASV DNSILLPLSS IIHVGRNLRK  540
ILQKKNKKSM NIPLRMHLKT TANTDSTKEF QNLGTSLTAN QCPSISIHRN LSKEVSTSLT  600
NTMILKKEVS GLRRKFTLGR TFRAKRRNVF QIDEMIDSEQ LYVAEIERLC SLENRLRNLK  660
NALLLCEYND YESVKTHSTE ENVTYVPVAE VKEQAFI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15863KRKRRK
25866KRKRRKRKK
36066KRRKRKK
46266RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010927238.10.0PREDICTED: pathogenesis-related homeodomain protein-like isoform X1
TrEMBLM0TT420.0M0TT42_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P23890_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85502227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.21e-126pathogenesis related homeodomain protein A